POMT2 Antikörper (Middle Region)

Produktnummer ABIN634940

Der Kaninchen-Polyklonal Anti-POMT2-Antikörper wurde für WB validiert. Er ist geeignet zum Nachweis von POMT2 in Proben aus Human, Maus und Ratte. }

Kurzübersicht für POMT2 Antikörper (Middle Region) (ABIN634940)

Target: POMT2 (Protein-O-Mannosyltransferase 2 (POMT2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser POMT2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-POMT2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: POMT2 antibody was raised against the middle region of POMT2

Aufreinigung: Affinity purified

Immunogen: POMT2 antibody was raised using the middle region of POMT2 corresponding to a region with amino acids RKHYQVTGYGINGTGDSNDFWRIEVVNRKFGNRIKVLRSRIRFIHLVTGC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

POMT2 Blocking Peptide, (ABIN5615470), is also available for use as a blocking control in assays to test for specificity of this POMT2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POMT2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu POMT2

Target: POMT2 (Protein-O-Mannosyltransferase 2 (POMT2))

Andere Bezeichnung: POMT2

Hintergrund: POMT2 encodes an integral membrane protein of the endoplasmic reticulum (ER) that shares significant sequence similarity with a family of protein O-mannosyltransferases of S.cerevisiae.

Molekulargewicht: 84 kDa (MW of target protein)