CMTM8 Antikörper (Middle Region)

Produktnummer ABIN634936

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch CMTM8 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für CMTM8 Antikörper (Middle Region) (ABIN634936)

Target: CMTM8 (CKLF-Like MARVEL Transmembrane Domain Containing 8 (CMTM8))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CMTM8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CMTM8 Antikörper

Bindungsspezifität: Middle Region

Spezifität: CMTM8 antibody was raised against the middle region of CMTM8

Aufreinigung: Affinity purified

Immunogen: CMTM8 antibody was raised using the middle region of CMTM8 corresponding to a region with amino acids CFNGSAFVLYLSAAVVDASSVSPERDSHNFNSWAASSFFAFLVTICYAGN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CMTM8 Blocking Peptide, (ABIN937072), is also available for use as a blocking control in assays to test for specificity of this CMTM8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CMTM8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CMTM8

Target: CMTM8 (CKLF-Like MARVEL Transmembrane Domain Containing 8 (CMTM8))

Andere Bezeichnung: CMTM8

Hintergrund: Cmtm8 gene belongs to the chemokine-like factor geneuperfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene is widely expressed in many tissues, but the exact function of the encoded protein is unknown. This gene belongs to the chemokine-like factor geneuperfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene is widely expressed in many tissues, but the exact function of the encoded protein is unknown.

Molekulargewicht: 19 kDa (MW of target protein)