CMTM8 Antikörper (Middle Region)

Produktnummer ABIN634936

Produktdetails anti-CMTM8 Antikörper

Target: CMTM8 (CKLF-Like MARVEL Transmembrane Domain Containing 8 (CMTM8))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CMTM8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CMTM8 antibody was raised against the middle region of CMTM8

Aufreinigung: Affinity purified

Immunogen: CMTM8 antibody was raised using the middle region of CMTM8 corresponding to a region with amino acids CFNGSAFVLYLSAAVVDASSVSPERDSHNFNSWAASSFFAFLVTICYAGN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CMTM8 Blocking Peptide, catalog no. 33R-1686, is also available for use as a blocking control in assays to test for specificity of this CMTM8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CMTM8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CMTM8

Target: CMTM8 (CKLF-Like MARVEL Transmembrane Domain Containing 8 (CMTM8))

Andere Bezeichnung: CMTM8 (CMTM8 Produkte)

Synonyme: MGC82744 antikoerper, marveld1 antikoerper, CKLFSF8 antikoerper, CKLFSF8-V2 antikoerper, 2700018N07Rik antikoerper, AA408515 antikoerper, Cklfsf8 antikoerper, CKLF-like MARVEL transmembrane domain containing 8 L homeolog antikoerper, CKLF like MARVEL transmembrane domain containing 8 antikoerper, CKLF-like MARVEL transmembrane domain containing 8 antikoerper, cmtm8.L antikoerper, CMTM8 antikoerper, cmtm8 antikoerper, Cmtm8 antikoerper

Hintergrund: Cmtm8 gene belongs to the chemokine-like factor geneuperfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene is widely expressed in many tissues, but the exact function of the encoded protein is unknown. This gene belongs to the chemokine-like factor geneuperfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene is widely expressed in many tissues, but the exact function of the encoded protein is unknown.

Molekulargewicht: 19 kDa (MW of target protein)