Matrix Metallopeptidase 24 (Membrane-inserted) (MMP24) Antikörper

Details zu Produkt Nr. ABIN634930
Antigen
Reaktivität
Human, Maus, Ratte (Rattus)
52
22
19
3
3
3
3
2
2
2
2
1
1
Wirt
Kaninchen
52
1
Klonalität
Polyklonal
Konjugat
Unkonjugiert
4
2
2
2
2
2
2
2
2
2
2
2
Applikation
Western Blotting (WB)
40
23
22
8
4
3
1
1
Optionen
Immunogen MMP24 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSCLPREGIDTALRWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVW
Reinigung Affinity purified
Antigen
Andere Bezeichnung MMP24 (MMP24 Antibody Abstract)
Hintergrund This protein activates MMP2 by cleavage. The gene has previously been referred to as MMP25 but has been renamed MMP24.
Molekulargewicht 57 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

MMP24 Blocking Peptide, catalog no. 33R-3551, is also available for use as a blocking control in assays to test for specificity of this MMP24 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP24 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Matrix Metallopeptidase 24 (Membrane-inserted) (MMP24) antibody (ABIN634930) MMP24 antibody used at 1 ug/ml to detect target protein.