MMP24 Antikörper

Produktnummer ABIN634930

Produktdetails anti-MMP24 Antikörper

Target: MMP24 (Matrix Metallopeptidase 24 (Membrane-inserted) (MMP24))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MMP24 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: MMP24 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSCLPREGIDTALRWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MMP24 Blocking Peptide, catalog no. 33R-3551, is also available for use as a blocking control in assays to test for specificity of this MMP24 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP24 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MMP24

Target: MMP24 (Matrix Metallopeptidase 24 (Membrane-inserted) (MMP24))

Andere Bezeichnung: MMP24 (MMP24 Produkte)

Synonyme: MMP-24 antikoerper, MMP25 antikoerper, MT-MMP 5 antikoerper, MT-MMP5 antikoerper, MT5-MMP antikoerper, MT5MMP antikoerper, MTMMP5 antikoerper, AU040325 antikoerper, Mt5-mmp antikoerper, si:ch211-239j9.5 antikoerper, MMP24 antikoerper, mt3-mmp antikoerper, matrix metallopeptidase 24 antikoerper, matrix metallopeptidase 16 S homeolog antikoerper, MMP24 antikoerper, Mmp24 antikoerper, mmp24 antikoerper, mmp16.S antikoerper

Hintergrund: This protein activates MMP2 by cleavage. The gene has previously been referred to as MMP25 but has been renamed MMP24.

Molekulargewicht: 57 kDa (MW of target protein)