TRIM59 Antikörper (N-Term)

Produktnummer ABIN634923

Dieses Anti-TRIM59-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von TRIM59 in WB. Geeignet für Human und Hund.

Kurzübersicht für TRIM59 Antikörper (N-Term) (ABIN634923)

Target: TRIM59 (Tripartite Motif Containing 59 (TRIM59))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRIM59 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TRIM59 Antikörper

Bindungsspezifität: N-Term

Spezifität: TRIM59 antibody was raised against the N terminal of TRIM59

Aufreinigung: Affinity purified

Immunogen: TRIM59 antibody was raised using the N terminal of TRIM59 corresponding to a region with amino acids RIPLKCPNCRSITEIAPTGIESLPVNFALRAIIEKYQQEDHPDIVTCPEH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRIM59 Blocking Peptide, (ABIN5616789), is also available for use as a blocking control in assays to test for specificity of this TRIM59 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM59 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRIM59

Target: TRIM59 (Tripartite Motif Containing 59 (TRIM59))

Andere Bezeichnung: TRIM59

Hintergrund: The function of TRIM59 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 44 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom