Surfeit 4 Antikörper (N-Term)
Kurzübersicht für Surfeit 4 Antikörper (N-Term) (ABIN634922)
Target
Alle Surfeit 4 (SURF4) Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- N-Term
-
Spezifität
- SURF4 antibody was raised against the N terminal of SURF4
-
Aufreinigung
- Affinity purified
-
Immunogen
- SURF4 antibody was raised using the N terminal of SURF4 corresponding to a region with amino acids GQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQ
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
SURF4 Blocking Peptide, (ABIN938890), is also available for use as a blocking control in assays to test for specificity of this SURF4 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SURF4 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- Surfeit 4 (SURF4)
-
Andere Bezeichnung
- SURF4
-
Hintergrund
- SURF4 is a conserved integral membrane protein containing multiple putative transmembrane regions. In eukaryotic cells, protein transport between the endoplasmic reticulum and Golgi compartments is mediated in part by non-clathrin-coated vesicular coat proteins (COPs). The specific function of this protein has not been determined but its yeast homolog is directly required for packaging glycosylated pro-alpha-factor into COPII vesicles.
-
Molekulargewicht
- 30 kDa (MW of target protein)
Target
-