Surfeit 4 Antikörper (N-Term)

Produktnummer ABIN634922

Der Kaninchen Polyklonal Anti-Surfeit 4-Antikörper wurde für WB validiert. Er ist geeignet, Surfeit 4 in Proben von Maus, Human und Ratte zu detektieren.

Kurzübersicht für Surfeit 4 Antikörper (N-Term) (ABIN634922)

Target: Surfeit 4 (SURF4)

Reaktivität: Maus, Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Surfeit 4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Surfeit 4 Antikörper

Bindungsspezifität: N-Term

Spezifität: SURF4 antibody was raised against the N terminal of SURF4

Aufreinigung: Affinity purified

Immunogen: SURF4 antibody was raised using the N terminal of SURF4 corresponding to a region with amino acids GQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SURF4 Blocking Peptide, (ABIN938890), is also available for use as a blocking control in assays to test for specificity of this SURF4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SURF4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Surfeit 4

Target: Surfeit 4 (SURF4)

Andere Bezeichnung: SURF4

Hintergrund: SURF4 is a conserved integral membrane protein containing multiple putative transmembrane regions. In eukaryotic cells, protein transport between the endoplasmic reticulum and Golgi compartments is mediated in part by non-clathrin-coated vesicular coat proteins (COPs). The specific function of this protein has not been determined but its yeast homolog is directly required for packaging glycosylated pro-alpha-factor into COPII vesicles.

Molekulargewicht: 30 kDa (MW of target protein)