HRK Antikörper

Produktnummer ABIN634918

Produktdetails anti-HRK Antikörper

Target: HRK (Harakiri, BCL2 Interacting Protein (Contains Only BH3 Domain) (HRK))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HRK Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: HRK antibody was raised using a synthetic peptide corresponding to a region with amino acids MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HRK Blocking Peptide, catalog no. 33R-5817, is also available for use as a blocking control in assays to test for specificity of this HRK antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HRK antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HRK

Target: HRK (Harakiri, BCL2 Interacting Protein (Contains Only BH3 Domain) (HRK))

Andere Bezeichnung: HRK (HRK Produkte)

Synonyme: DP5 antikoerper, HARAKIRI antikoerper, AI838259 antikoerper, Bid3 antikoerper, harakiri antikoerper, Dp5 antikoerper, harakiri, BCL2 interacting protein antikoerper, harakiri, BCL2 interacting protein (contains only BH3 domain) antikoerper, HRK antikoerper, Hrk antikoerper

Hintergrund: Activator of apoptosis Hrk regulates apoptosis through interaction with death-repressor proteins Bcl-2 and Bcl-X(L). The HRK protein lacks significant homology to other BCL2 family members.

Molekulargewicht: 10 kDa (MW of target protein)