DISP1 Antikörper
-
- Target Alle DISP1 Antikörper anzeigen
- DISP1 (Dispatched Homolog 1 (DISP1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DISP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- DISP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FVLCDVWNYTKFDKPHAETSETVSITLQHAALSMFVTSFTTAAAFYANYV
- Top Product
- Discover our top product DISP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DISP1 Blocking Peptide, catalog no. 33R-3115, is also available for use as a blocking control in assays to test for specificity of this DISP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DISP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DISP1 (Dispatched Homolog 1 (DISP1))
- Andere Bezeichnung
- DISP1 (DISP1 Produkte)
- Synonyme
- DISP1 antikoerper, DISPA antikoerper, 1190008H24Rik antikoerper, DispA antikoerper, con antikoerper, zgc:111866 antikoerper, dispatched antikoerper, dispatched RND transporter family member 1 antikoerper, dispatched homolog 1 (Drosophila) antikoerper, CpipJ_CPIJ008642 antikoerper, DISP1 antikoerper, Disp1 antikoerper, disp1 antikoerper
- Hintergrund
- DISP1 functions in hedgehog (Hh) signaling. Regulates the release and extracellular accumulation of cholesterol-modified hedgehog proteins and is hence required for effective production of the Hh signal. The pattern of cellular proliferation and differentiation that leads to normal development of embryonic structures often depends upon the localized production of secreted protein signals. Cells surrounding the source of a particular signal respond in a graded manner according to the effective concentration of the signal, and this response produces the pattern of cell types constituting the mature structure.
- Molekulargewicht
- 171 kDa (MW of target protein)
- Pathways
- Hedgehog Signalweg
-