DISP1 Antikörper (Dispatched Homolog 1 (Drosophila))

Details for Product anti-DISP1 Antibody No. ABIN634914
Antigen
Reaktivität
Human
24
10
2
2
2
1
1
1
1
Wirt
Kaninchen
19
7
Klonalität
Polyklonal
Konjugat
Dieser DISP1 Antikörper ist unkonjugiert
1
1
1
1
1
1
Applikation
Western Blotting (WB)
25
16
6
5
4
1
1
Optionen
Immunogen DISP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FVLCDVWNYTKFDKPHAETSETVSITLQHAALSMFVTSFTTAAAFYANYV
Reinigung Affinity purified
Antigen
Andere Bezeichnung DISP1 (DISP1 Antibody Abstract)
Hintergrund DISP1 functions in hedgehog (Hh) signaling. Regulates the release and extracellular accumulation of cholesterol-modified hedgehog proteins and is hence required for effective production of the Hh signal. The pattern of cellular proliferation and differentiation that leads to normal development of embryonic structures often depends upon the localized production of secreted protein signals. Cells surrounding the source of a particular signal respond in a graded manner according to the effective concentration of the signal, and this response produces the pattern of cell types constituting the mature structure.
Molekulargewicht 171 kDa (MW of target protein)
Pathways Hedgehog Signalweg
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

DISP1 Blocking Peptide, catalog no. 33R-3115, is also available for use as a blocking control in assays to test for specificity of this DISP1 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DISP1 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Dispatched Homolog 1 (Drosophila) (DISP1) antibody (ABIN634914) DISP1 antibody used at 1 ug/ml to detect target protein.