Claudin Domain Containing 1 (CLDND1) (Middle Region) Antikörper

Details zu Produkt Nr. ABIN634913
Antigen
Epitop
Middle Region
10
8
8
7
2
1
Reaktivität
Human, Maus, Ratte (Rattus)
38
25
10
2
2
2
2
1
1
1
Wirt
Kaninchen
41
Klonalität
Polyklonal
Konjugat
Unkonjugiert
3
2
2
2
2
2
1
1
1
1
1
1
Applikation
Western Blotting (WB)
33
21
8
2
1
1
1
Optionen
Immunogen Claudin Domain Containing 1 antibody was raised using the middle region of CLDND1 corresponding to a region with amino acids TLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGL
Spezifität Claudin Domain Containing 1 antibody was raised against the middle region of CLDND1
Reinigung Affinity purified
Antigen
Andere Bezeichnung Claudin Domain Containing 1
Hintergrund CLDND1 belongs to the PMP-22/EMP/MP20 family. The exact function of CLDND1 remains unknown.
Molekulargewicht 28 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

Claudin Domain Containing 1 Blocking Peptide, catalog no. 33R-9186, is also available for use as a blocking control in assays to test for specificity of this Claudin Domain Containing 1 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDND1 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Claudin Domain Containing 1 (CLDND1) (Middle Region) antibody (ABIN634913) Claudin Domain Containing 1 antibody used at 1 ug/ml to detect target protein.