CLDND1 Antikörper (Middle Region)

Produktnummer ABIN634913

Der Kaninchen Polyklonal Anti-CLDND1 Antikörper wurde für WB validiert. Er ist geeignet, CLDND1 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für CLDND1 Antikörper (Middle Region) (ABIN634913)

Target: CLDND1 (Claudin Domain Containing 1 (CLDND1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CLDND1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CLDND1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: Claudin Domain Containing 1 antibody was raised against the middle region of CLDND1

Aufreinigung: Affinity purified

Immunogen: Claudin Domain Containing 1 antibody was raised using the middle region of CLDND1 corresponding to a region with amino acids TLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Claudin Domain Containing 1 Blocking Peptide, (ABIN5612911), is also available for use as a blocking control in assays to test for specificity of this Claudin Domain Containing 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDND1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CLDND1

Target: CLDND1 (Claudin Domain Containing 1 (CLDND1))

Andere Bezeichnung: Claudin Domain Containing 1

Hintergrund: CLDND1 belongs to the PMP-22/EMP/MP20 family. The exact function of CLDND1 remains unknown.

Molekulargewicht: 28 kDa (MW of target protein)