LST-3TM12 Antikörper (Middle Region)

Produktnummer ABIN634912

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch LST-3TM12 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für LST-3TM12 Antikörper (Middle Region) (ABIN634912)

Target: LST-3TM12 (Organic Anion Transporter LST-3b (LST-3TM12))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LST-3TM12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LST-3TM12 Antikörper

Bindungsspezifität: Middle Region

Spezifität: LST-3 TM12 antibody was raised against the middle region of LST-3 M12

Aufreinigung: Affinity purified

Immunogen: LST-3 TM12 antibody was raised using the middle region of LST-3 M12 corresponding to a region with amino acids LKTNDKRNQIANLTNRRKYITKNVTGFFQSLKSILTNPLYVIFVIFTLLH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LST-3TM12 Blocking Peptide, (ABIN940495), is also available for use as a blocking control in assays to test for specificity of this LST-3TM12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LST-0 M12 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LST-3TM12

Target: LST-3TM12 (Organic Anion Transporter LST-3b (LST-3TM12))

Andere Bezeichnung: LST-3TM12

Hintergrund: The function of LST-3TM12 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 71 kDa (MW of target protein)