Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

LST-3TM12 Antikörper (Middle Region)

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch LST-3TM12 in WB. Er zeigt eine Reaktivität gegenüber Human.
Produktnummer ABIN634912

Kurzübersicht für LST-3TM12 Antikörper (Middle Region) (ABIN634912)

Target

LST-3TM12 (Organic Anion Transporter LST-3b (LST-3TM12))

Reaktivität

  • 5
  • 1
Human

Wirt

  • 5
Kaninchen

Klonalität

  • 5
Polyklonal

Konjugat

  • 5
Dieser LST-3TM12 Antikörper ist unkonjugiert

Applikation

  • 5
  • 1
Western Blotting (WB)
  • Bindungsspezifität

    • 2
    • 1
    • 1
    Middle Region

    Spezifität

    LST-3 TM12 antibody was raised against the middle region of LST-3 M12

    Aufreinigung

    Affinity purified

    Immunogen

    LST-3 TM12 antibody was raised using the middle region of LST-3 M12 corresponding to a region with amino acids LKTNDKRNQIANLTNRRKYITKNVTGFFQSLKSILTNPLYVIFVIFTLLH
  • Applikationshinweise

    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.

    Kommentare

    LST-3TM12 Blocking Peptide, (ABIN940495), is also available for use as a blocking control in assays to test for specificity of this LST-3TM12 antibody

    Beschränkungen

    Nur für Forschungszwecke einsetzbar
  • Format

    Lyophilized

    Rekonstitution

    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LST-0 M12 antibody in PBS

    Konzentration

    Lot specific

    Buffer

    PBS

    Handhabung

    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.

    Lagerung

    4 °C/-20 °C

    Informationen zur Lagerung

    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target

    LST-3TM12 (Organic Anion Transporter LST-3b (LST-3TM12))

    Andere Bezeichnung

    LST-3TM12

    Hintergrund

    The function of LST-3TM12 protein has not been widely studied, and is yet to be fully elucidated.

    Molekulargewicht

    71 kDa (MW of target protein)
Sie sind hier:
Chat with us!