Occludin Antikörper (N-Term)

Produktnummer ABIN634908

Dieses Anti-Occludin-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Occludin in WB. Geeignet für Human, Maus, Ratte und Hund.

Kurzübersicht für Occludin Antikörper (N-Term) (ABIN634908)

Target: Occludin (OCLN)

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Occludin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Occludin Antikörper

Bindungsspezifität: N-Term

Spezifität: Occludin antibody was raised against the N terminal of OCLN

Aufreinigung: Affinity purified

Immunogen: Occludin antibody was raised using the N terminal of OCLN corresponding to a region with amino acids VRPMLSQPAYSFYPEDEILHFYKWTSPPGVIRILSMLIIVMCIAIFACVA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Occludin Blocking Peptide, (ABIN5615105), is also available for use as a blocking control in assays to test for specificity of this Occludin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OCLN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Occludin

Target: Occludin (OCLN)

Andere Bezeichnung: Occludin

Hintergrund: OCLN is an integral membrane protein which is located at tight junctions. This protein may be involved in the formation and maintenance of the tight junction. The possibility of several alternatively spliced products has been suggested but the full nature of these products has not been described. This gene encodes an integral membrane protein which is located at tight junctions. This protein may be involved in the formation and maintenance of the tight junction. The possibility of several alternatively spliced products has been suggested but the full nature of these products has not been described.

Molekulargewicht: 59 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Hepatitis C