Tricellulin Antikörper (Middle Region)

Produktnummer ABIN634907

Der Kaninchen Polyklonal anti-Tricellulin Antikörper wird verwendet zum Nachweis von Tricellulin in Proben von Human und Maus. Er wurde validiert für WB.

Kurzübersicht für Tricellulin Antikörper (Middle Region) (ABIN634907)

Target: Tricellulin (MARVELD2)

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Tricellulin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Tricellulin Antikörper

Bindungsspezifität: Middle Region

Spezifität: MARVELD2 antibody was raised against the middle region of MARVELD2

Aufreinigung: Affinity purified

Immunogen: MARVELD2 antibody was raised using the middle region of MARVELD2 corresponding to a region with amino acids PKTPFVLVVAGLAWITTIIILVLGMSMYYRTILLDSNWWPLTEFGINVAL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MARVELD2 Blocking Peptide, (ABIN5614673), is also available for use as a blocking control in assays to test for specificity of this MARVELD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MARVELD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Tricellulin

Target: Tricellulin (MARVELD2)

Andere Bezeichnung: MARVELD2

Hintergrund: Tight junctions (TJ) prevent leakage of solutes through the paracellular pathway of epithelial cells. MARVELD2, or tricellulin (TRIC), is an integral membrane protein concentrated at the vertically oriented TJ strands of tricellular contacts.

Molekulargewicht: 52 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Cell-Cell Junction Organization