-
- Target Alle DNAJC25 Produkte
- DNAJC25 (DnaJ (Hsp40) Homolog, Subfamily C , Member 25 (DNAJC25))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DNAJC25 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- DNAJC25 antibody was raised using a synthetic peptide corresponding to a region with amino acids RDEEENIIKNIIKSKIDIKGGYQKPQICDLLLFQIILAPFHLCSYIVWYC
-
anti-DnaJ (Hsp40) Homolog, Subfamily C , Member 25 (DNAJC25) (AA 281-360) antibody
DNAJC25 Reaktivität: Human WB, IF (cc), IF (p), ELISA, IHC (fro), IHC (p), ICC Wirt: Kaninchen Polyclonal unconjugated
anti-DnaJ (Hsp40) Homolog, Subfamily C , Member 25 (DNAJC25) (AA 211-239) antibodyDNAJC25 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB40900 unconjugated
anti-DnaJ (Hsp40) Homolog, Subfamily C , Member 25 (DNAJC25) (AA 215-264) antibodyDNAJC25 Reaktivität: Human, Rind (Kuh), Meerschweinchen, Hund, Pferd, Maus, Ratte, Kaninchen, Affe, Hamster WB Wirt: Kaninchen Polyclonal unconjugated
anti-DnaJ (Hsp40) Homolog, Subfamily C , Member 25 (DNAJC25) (AA 173-222) antibodyDNAJC25 Reaktivität: Human, Hund, Pferd, Maus, Ratte, Affe, Schwein, Hamster, Fledermaus WB Wirt: Kaninchen Polyclonal unconjugated
anti-DnaJ (Hsp40) Homolog, Subfamily C , Member 25 (DNAJC25) (AA 36-85) antibodyDNAJC25 Reaktivität: Human, Rind (Kuh), Meerschweinchen, Affe WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DNAJC25 Blocking Peptide, catalog no. 33R-7841, is also available for use as a blocking control in assays to test for specificity of this DNAJC25 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJC25 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DNAJC25 (DnaJ (Hsp40) Homolog, Subfamily C , Member 25 (DNAJC25))
- Andere Bezeichnung
- DNAJC25 (DNAJC25 Produkte)
- Hintergrund
- DNAJC25 may be involved in heat shock protein binding.
- Molekulargewicht
- 42 kDa (MW of target protein)
-
Sie sind hier:
