DNAJC25 Antikörper (DnaJ (Hsp40) Homolog, Subfamily C , Member 25)

Details for Product anti-DNAJC25 Antibody No. ABIN634906
Antigen
Reaktivität
Human
26
7
7
4
4
4
4
3
3
2
2
2
1
Wirt
Kaninchen
26
Klonalität
Polyklonal
Konjugat
Dieser DNAJC25 Antikörper ist unkonjugiert
3
3
2
2
2
2
Applikation
Western Blotting (WB)
26
14
Optionen
Immunogen DNAJC25 antibody was raised using a synthetic peptide corresponding to a region with amino acids RDEEENIIKNIIKSKIDIKGGYQKPQICDLLLFQIILAPFHLCSYIVWYC
Reinigung Affinity purified
Antigen
Andere Bezeichnung DNAJC25
Hintergrund DNAJC25 may be involved in heat shock protein binding.
Molekulargewicht 42 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

DNAJC25 Blocking Peptide, catalog no. 33R-7841, is also available for use as a blocking control in assays to test for specificity of this DNAJC25 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJC25 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-DnaJ (Hsp40) Homolog, Subfamily C , Member 25 (DNAJC25) antibody (ABIN634906) DNAJC25 antibody used at 1 ug/ml to detect target protein.