DNAJC25 Antikörper
-
- Target Alle DNAJC25 Produkte
- DNAJC25 (DnaJ (Hsp40) Homolog, Subfamily C , Member 25 (DNAJC25))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DNAJC25 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- DNAJC25 antibody was raised using a synthetic peptide corresponding to a region with amino acids RDEEENIIKNIIKSKIDIKGGYQKPQICDLLLFQIILAPFHLCSYIVWYC
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DNAJC25 Blocking Peptide, catalog no. 33R-7841, is also available for use as a blocking control in assays to test for specificity of this DNAJC25 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJC25 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DNAJC25 (DnaJ (Hsp40) Homolog, Subfamily C , Member 25 (DNAJC25))
- Andere Bezeichnung
- DNAJC25 (DNAJC25 Produkte)
- Synonyme
- bA16L21.2.1 antikoerper, ERJ7 antikoerper, GNG10 antikoerper, dnj2 antikoerper, dnajc25 antikoerper, 2010109C08Rik antikoerper, 2010203O07Rik antikoerper, Dnajc25 antikoerper, DnaJ heat shock protein family (Hsp40) member C25 antikoerper, DnaJ heat shock protein family (Hsp40) member C25 S homeolog antikoerper, DnaJ (Hsp40) homolog, subfamily C , member 25 antikoerper, dnaJ homolog subfamily C member 25 antikoerper, DNAJC25 antikoerper, dnajc25 antikoerper, dnajc25.S antikoerper, Dnajc25 antikoerper, LOC100730599 antikoerper
- Hintergrund
- DNAJC25 may be involved in heat shock protein binding.
- Molekulargewicht
- 42 kDa (MW of target protein)
-