DNAJC25 Antikörper

Produktnummer ABIN634906

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch DNAJC25 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für DNAJC25 Antikörper (ABIN634906)

Target: DNAJC25 (DnaJ (Hsp40) Homolog, Subfamily C , Member 25 (DNAJC25))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DNAJC25 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DNAJC25 Antikörper

Aufreinigung: Affinity purified

Immunogen: DNAJC25 antibody was raised using a synthetic peptide corresponding to a region with amino acids RDEEENIIKNIIKSKIDIKGGYQKPQICDLLLFQIILAPFHLCSYIVWYC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DNAJC25 Blocking Peptide, (ABIN5613233), is also available for use as a blocking control in assays to test for specificity of this DNAJC25 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJC25 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DNAJC25

Target: DNAJC25 (DnaJ (Hsp40) Homolog, Subfamily C , Member 25 (DNAJC25))

Andere Bezeichnung: DNAJC25

Hintergrund: DNAJC25 may be involved in heat shock protein binding.

Molekulargewicht: 42 kDa (MW of target protein)