DPP6 Antikörper (Middle Region)

Produktnummer ABIN634901

Produktdetails anti-DPP6 Antikörper

Target: DPP6 (Dipeptidyl-Peptidase 6 (DPP6))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DPP6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DPP6 antibody was raised against the middle region of DPP6

Aufreinigung: Affinity purified

Immunogen: DPP6 antibody was raised using the middle region of DPP6 corresponding to a region with amino acids FLIIHPTADEKIHFQHTAELITQLIRGKANYSLQIYPDESHYFTSSSLKQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DPP6 Blocking Peptide, catalog no. 33R-2964, is also available for use as a blocking control in assays to test for specificity of this DPP6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPP6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DPP6

Target: DPP6 (Dipeptidyl-Peptidase 6 (DPP6))

Andere Bezeichnung: DPP6 (DPP6 Produkte)

Synonyme: dppx antikoerper, DPPX antikoerper, VF2 antikoerper, DPP VI antikoerper, dpp6 antikoerper, si:ch211-198f16.1 antikoerper, B930011P16Rik antikoerper, D5Buc3 antikoerper, D5Buc4 antikoerper, D5Buc5 antikoerper, Dpp-6 antikoerper, Gm1377 antikoerper, In(5)6H-p antikoerper, Peplb antikoerper, Rw antikoerper, dipeptidyl peptidase like 6 antikoerper, dipeptidyl-peptidase 6 antikoerper, dipeptidyl-peptidase 6b antikoerper, dipeptidylpeptidase 6 antikoerper, DPP6 antikoerper, dpp6 antikoerper, BCAN_A2221 antikoerper, BSUIS_A2016 antikoerper, Bsph_2289 antikoerper, BMEA_A2239 antikoerper, dpp6b antikoerper, Dpp6 antikoerper

Hintergrund: DPP6 is a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties.

Molekulargewicht: 91 kDa (MW of target protein)