Solute Carrier Family 30 (Zinc Transporter), Member 8 (SLC30A8) Antikörper

Details zu Produkt Nr. ABIN634898
Antigen
Reaktivität
Human
39
9
7
2
2
1
1
1
1
1
1
Wirt
Kaninchen
38
1
Klonalität
Polyklonal
Konjugat
Unkonjugiert
6
5
2
Applikation
Western Blotting (WB)
34
19
14
6
3
3
2
1
Optionen
Immunogen SLC30 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLIDLTSFLLSLFSLWLSSKPPSKRLTFGWHRAEILGALLSILCIWVVTG
Reinigung Affinity purified
Antigen
Andere Bezeichnung SLC30A8 (SLC30A8 Antibody Abstract)
Hintergrund The protein encoded by this gene is a zinc efflux transporter involved in the accumulation of zinc in intracellular vesicles. This gene is expressed at a high level only in the pancreas, particularly in islets of Langerhans.
Molekulargewicht 41 kDa (MW of target protein)
Pathways Positive Regulation of Peptide Hormone Secretion, Hormone Transport, Carbohydrate Homeostasis, Transition Metal Ion Homeostasis
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

SLC30A8 Blocking Peptide, catalog no. 33R-5148, is also available for use as a blocking control in assays to test for specificity of this SLC30A8 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 8 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Solute Carrier Family 30 (Zinc Transporter), Member 8 (SLC30A8) antibody (ABIN634898) SLC30A8 antibody used at 1 ug/ml to detect target protein.