SLC30A8 Antikörper

Produktnummer ABIN634898

Der Kaninchen Polyklonal Anti-SLC30A8 Antikörper wurde für WB validiert. Er ist geeignet, SLC30A8 in Proben von Human zu detektieren.

Kurzübersicht für SLC30A8 Antikörper (ABIN634898)

Target: SLC30A8 (Solute Carrier Family 30 (Zinc Transporter), Member 8 (SLC30A8))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC30A8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC30A8 Antikörper

Aufreinigung: Affinity purified

Immunogen: SLC30 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLIDLTSFLLSLFSLWLSSKPPSKRLTFGWHRAEILGALLSILCIWVVTG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC30A8 Blocking Peptide, (ABIN940534), is also available for use as a blocking control in assays to test for specificity of this SLC30A8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC30A8

Target: SLC30A8 (Solute Carrier Family 30 (Zinc Transporter), Member 8 (SLC30A8))

Andere Bezeichnung: SLC30A8

Hintergrund: The protein encoded by this gene is a zinc efflux transporter involved in the accumulation of zinc in intracellular vesicles. This gene is expressed at a high level only in the pancreas, particularly in islets of Langerhans.

Molekulargewicht: 41 kDa (MW of target protein)

Pathways: Positive Regulation of Peptide Hormone Secretion, Hormone Transport, Carbohydrate Homeostasis, Transition Metal Ion Homeostasis