ST8SIA6 Antikörper (Middle Region)

Produktnummer ABIN634897

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch ST8SIA6 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für ST8SIA6 Antikörper (Middle Region) (ABIN634897)

Target: ST8SIA6 (ST8 alpha-N-Acetyl-Neuraminide alpha-2,8-Sialyltransferase 6 (ST8SIA6))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ST8SIA6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ST8SIA6 Antikörper

Bindungsspezifität: Middle Region

Spezifität: ST8 SIA6 antibody was raised against the middle region of ST8 IA6

Aufreinigung: Affinity purified

Immunogen: ST8 SIA6 antibody was raised using the middle region of ST8 IA6 corresponding to a region with amino acids LEESKARQKVLFFHPKYLKDLALFWRTKGVTAYRLSTGLMITSVAVELCK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ST8SIA6 Blocking Peptide, (ABIN940279), is also available for use as a blocking control in assays to test for specificity of this ST8SIA6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 IA6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ST8SIA6

Target: ST8SIA6 (ST8 alpha-N-Acetyl-Neuraminide alpha-2,8-Sialyltransferase 6 (ST8SIA6))

Andere Bezeichnung: ST8SIA6

Hintergrund: Sialic acid is a key determinate of oligosaccharide structures involved in cell-cell communication, cell-substrate interaction, adhesion, and protein targeting.

Molekulargewicht: 45 kDa (MW of target protein)