LRRC52 Antikörper (N-Term)

Produktnummer ABIN634893

Produktdetails anti-LRRC52 Antikörper

Target: LRRC52 (Leucine Rich Repeat Containing 52 (LRRC52))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LRRC52 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LRRC52 antibody was raised against the N terminal of LRRC52

Aufreinigung: Affinity purified

Immunogen: LRRC52 antibody was raised using the N terminal of LRRC52 corresponding to a region with amino acids QEVICTGKQLTEYPLDIPLNTRRLFLNENRITSLPAMHLGLLSDLVYLDC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LRRC52 Blocking Peptide, catalog no. 33R-7542, is also available for use as a blocking control in assays to test for specificity of this LRRC52 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC52 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LRRC52

Target: LRRC52 (Leucine Rich Repeat Containing 52 (LRRC52))

Andere Bezeichnung: LRRC52 (LRRC52 Produkte)

Synonyme: 4930413P14Rik antikoerper, leucine rich repeat containing 52 antikoerper, LRRC52 antikoerper, Lrrc52 antikoerper

Hintergrund: The function of LRRC52 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 35 kDa (MW of target protein)