Tmc2 Antikörper (Middle Region)

Produktnummer ABIN634892

Produktdetails anti-Tmc2 Antikörper

Target: Tmc2 (Transmembrane Channel-Like 2 (Tmc2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Tmc2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMC2 antibody was raised against the middle region of TMC2

Aufreinigung: Affinity purified

Immunogen: TMC2 antibody was raised using the middle region of TMC2 corresponding to a region with amino acids YCWCWDLEAGFPSYAEFDISGNVLGLIFNQGMIWMGSFYAPGLVGINVLR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMC2 Blocking Peptide, catalog no. 33R-10062, is also available for use as a blocking control in assays to test for specificity of this TMC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMC2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Tmc2

Target: Tmc2 (Transmembrane Channel-Like 2 (Tmc2))

Andere Bezeichnung: TMC2 (Tmc2 Produkte)

Synonyme: C20orf145 antikoerper, dJ686C3.3 antikoerper, CWEA2 antikoerper, transmembrane channel like 2 antikoerper, transmembrane channel-like 2 antikoerper, transmembrane channel-like gene family 2 antikoerper, TMC2 antikoerper, Tmc2 antikoerper

Hintergrund: TMC2 is considered a member of transmembrane proteins family. The specific function of this gene is unknown, however, expression in the inner ear suggests that it may be crucial for normal auditory function. This gene is considered a member of a gene family predicted to encode transmembrane proteins.

Molekulargewicht: 102 kDa (MW of target protein)