GRAMD2 Antikörper (GRAM Domain Containing 2) (Middle Region)

Details for Product anti-GRAMD2 Antibody No. ABIN634882
Antigen
Epitop
Middle Region
1
1
Reaktivität
Human
19
16
16
2
2
2
1
1
1
1
1
Wirt
Kaninchen
19
Klonalität
Polyklonal
Konjugat
Dieser GRAMD2 Antikörper ist unkonjugiert
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
13
6
4
1
Optionen
Immunogen GRAMD2 antibody was raised using the middle region of GRAMD2 corresponding to a region with amino acids LPNGLAITTNTSQKYIFVSLLSRDSVYDLLRRVCTHLQPSSKKSLSVREF
Spezifität GRAMD2 antibody was raised against the middle region of GRAMD2
Reinigung Affinity purified
Antigen
Andere Bezeichnung GRAMD2
Hintergrund The function of GRAMD2 protein has not been widely studied, and is yet to be fully elucidated.
Molekulargewicht 40 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

GRAMD2 Blocking Peptide, catalog no. 33R-5276, is also available for use as a blocking control in assays to test for specificity of this GRAMD2 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRAMD2 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-GRAM Domain Containing 2 (GRAMD2) (Middle Region) antibody (ABIN634882) GRAMD2 antibody used at 1 ug/ml to detect target protein.