SLC26A1 Antikörper

Produktnummer ABIN634881

Dieses Anti-SLC26A1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von SLC26A1 in IHC und WB. Geeignet für Human.

Kurzübersicht für SLC26A1 Antikörper (ABIN634881)

Target: SLC26A1 (Solute Carrier Family 26 (Sulfate Transporter), Member 1 (SLC26A1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC26A1 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC), Western Blotting (WB)

Produktdetails anti-SLC26A1 Antikörper

Aufreinigung: Affinity purified

Immunogen: SLC26 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LYSLTGLDAGCMAARRKEGGSETGVGEGGPAQGEDLGPVSTRAALVPAAA

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC26A1 Blocking Peptide, (ABIN5616230), is also available for use as a blocking control in assays to test for specificity of this SLC26A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC26A1

Target: SLC26A1 (Solute Carrier Family 26 (Sulfate Transporter), Member 1 (SLC26A1))

Andere Bezeichnung: SLC26A1

Hintergrund: SLC26A1 is a member of sulfate/anion transporter family. Family members are well conserved in their protein (aa length among species) structures, but have markedly different tissue expression patterns. Its gene is primarily expressed in the liver, pancreas, and brain.

Molekulargewicht: 77 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process, Ribonucleoside Biosynthetic Process, Dicarboxylic Acid Transport