SLC26A1 Antikörper
-
- Target Alle SLC26A1 Antikörper anzeigen
- SLC26A1 (Solute Carrier Family 26 (Sulfate Transporter), Member 1 (SLC26A1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC26A1 Antikörper ist unkonjugiert
-
Applikation
- Immunohistochemistry (IHC), Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC26 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LYSLTGLDAGCMAARRKEGGSETGVGEGGPAQGEDLGPVSTRAALVPAAA
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC26A1 Blocking Peptide, catalog no. 33R-5575, is also available for use as a blocking control in assays to test for specificity of this SLC26A1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC26A1 (Solute Carrier Family 26 (Sulfate Transporter), Member 1 (SLC26A1))
- Andere Bezeichnung
- SLC26A1 (SLC26A1 Produkte)
- Hintergrund
- SLC26A1 is a member of sulfate/anion transporter family. Family members are well conserved in their protein (aa length among species) structures, but have markedly different tissue expression patterns. Its gene is primarily expressed in the liver, pancreas, and brain.
- Molekulargewicht
- 77 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process, Ribonucleoside Biosynthetic Process, Dicarboxylic Acid Transport
-