LEMD2 Antikörper (LEM Domain Containing 2) (Middle Region)

Details for Product anti-LEMD2 Antibody No. ABIN634879
Antigen
Epitop
Middle Region
15
7
4
4
3
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
32
7
5
4
4
4
4
3
2
2
2
1
Wirt
Kaninchen
32
Klonalität
Polyklonal
Konjugat
Dieser LEMD2 Antikörper ist unkonjugiert
3
3
3
2
2
2
Applikation
Western Blotting (WB)
28
22
3
2
1
1
1
Optionen
Immunogen LEMD2 antibody was raised using the middle region of LEMD2 corresponding to a region with amino acids QDMERYPYVGILHVRDSLIPPQSRRRMKRVWDRAVEFLASNESRIQTESH
Spezifität LEMD2 antibody was raised against the middle region of LEMD2
Reinigung Affinity purified
Antigen
Andere Bezeichnung LEMD2 (LEMD2 Antibody Abstract)
Hintergrund LEMD2 is involved in nuclear structure organization.
Molekulargewicht 57 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

LEMD2 Blocking Peptide, catalog no. 33R-7506, is also available for use as a blocking control in assays to test for specificity of this LEMD2 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LEMD2 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-LEM Domain Containing 2 (LEMD2) (Middle Region) antibody (ABIN634879) LEMD2 antibody used at 1 ug/ml to detect target protein.