GPR75 Antikörper (Middle Region)

Produktnummer ABIN634877

Der Kaninchen-Polyklonal Anti-GPR75-Antikörper wurde für WB validiert. Er ist geeignet zum Nachweis von GPR75 in Proben aus Human, Maus und Ratte. }

Kurzübersicht für GPR75 Antikörper (Middle Region) (ABIN634877)

Target: GPR75 (G Protein-Coupled Receptor 75 (GPR75))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GPR75 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GPR75 Antikörper

Bindungsspezifität: Middle Region

Spezifität: GPR75 antibody was raised against the middle region of GPR75

Aufreinigung: Affinity purified

Immunogen: GPR75 antibody was raised using the middle region of GPR75 corresponding to a region with amino acids GQSSSTPINTRIEPYYSIYNSSPSQEESSPCNLQPVNSFGFANSYIAMHY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GPR75 Blocking Peptide, (ABIN938899), is also available for use as a blocking control in assays to test for specificity of this GPR75 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPR75 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GPR75

Target: GPR75 (G Protein-Coupled Receptor 75 (GPR75))

Andere Bezeichnung: GPR75

Hintergrund: GPR75 is a member of the G protein-coupled receptor family. GPRs are cell surface receptors that activate guanine-nucleotide binding proteins upon the binding of a ligand.GPR75 is a member of the G protein-coupled receptor family. GPRs are cell surface receptors that activate guanine-nucleotide binding proteins upon the binding of a ligand.

Molekulargewicht: 59 kDa (MW of target protein)