MT-ND6 Antikörper

Produktnummer ABIN634876

Produktdetails anti-MT-ND6 Antikörper

Target: MT-ND6 (Mitochondrially Encoded NADH Dehydrogenase 6 (MT-ND6))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MT-ND6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ND6 antibody was raised using a synthetic peptide corresponding to a region with amino acids DGVVVVVNFNSVGSWMIYEGEGSGLIREDPIGAGALYDYGRWLVVVTGWT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ND6 Blocking Peptide, catalog no. 33R-1970, is also available for use as a blocking control in assays to test for specificity of this ND6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ND6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MT-ND6

Target: MT-ND6 (Mitochondrially Encoded NADH Dehydrogenase 6 (MT-ND6))

Andere Bezeichnung: ND6 (MT-ND6 Produkte)

Synonyme: MTND6 antikoerper, NADH6 antikoerper, mitochondrial NADH-ubiquinone oxidoreductase chain 6 antikoerper, NADH dehydrogenase, subunit 6 (complex I) antikoerper, NADH dehydrogenase subunit 6 antikoerper, NADH dehydrogenasesubunit 6 antikoerper, mt:ND6 antikoerper, ND6 antikoerper, nad6 antikoerper

Hintergrund: ND6 is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone

Molekulargewicht: 19 kDa (MW of target protein)