MT-ND6 Antikörper
-
- Target Alle MT-ND6 Antikörper anzeigen
- MT-ND6 (Mitochondrially Encoded NADH Dehydrogenase 6 (MT-ND6))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MT-ND6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ND6 antibody was raised using a synthetic peptide corresponding to a region with amino acids DGVVVVVNFNSVGSWMIYEGEGSGLIREDPIGAGALYDYGRWLVVVTGWT
- Top Product
- Discover our top product MT-ND6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ND6 Blocking Peptide, catalog no. 33R-1970, is also available for use as a blocking control in assays to test for specificity of this ND6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ND6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MT-ND6 (Mitochondrially Encoded NADH Dehydrogenase 6 (MT-ND6))
- Andere Bezeichnung
- ND6 (MT-ND6 Produkte)
- Hintergrund
- ND6 is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone
- Molekulargewicht
- 19 kDa (MW of target protein)
-