Mitochondrially Encoded NADH Dehydrogenase 6 (MT-ND6) Antikörper

Details zu Produkt Nr. ABIN634876
Antigen
Reaktivität
Human
30
20
19
1
1
Wirt
Kaninchen
32
Klonalität
Polyklonal
Konjugat
Unkonjugiert
2
2
2
2
2
2
2
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
13
11
7
6
3
1
Optionen
Immunogen ND6 antibody was raised using a synthetic peptide corresponding to a region with amino acids DGVVVVVNFNSVGSWMIYEGEGSGLIREDPIGAGALYDYGRWLVVVTGWT
Reinigung Affinity purified
Antigen
Andere Bezeichnung ND6 (MT-ND6 Antibody Abstract)
Hintergrund ND6 is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone
Molekulargewicht 19 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

ND6 Blocking Peptide, catalog no. 33R-1970, is also available for use as a blocking control in assays to test for specificity of this ND6 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ND6 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Mitochondrially Encoded NADH Dehydrogenase 6 (MT-ND6) antibody (ABIN634876) ND6 antibody used at 1 ug/ml to detect target protein.