SEC22C Antikörper

Produktnummer ABIN634875

Produktdetails anti-SEC22C Antikörper

Target: SEC22C (SEC22 Vesicle Trafficking Protein Homolog C (SEC22C))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SEC22C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SEC22 C antibody was raised using a synthetic peptide corresponding to a region with amino acids FRMEPVTALGILSLILNIMCAALNLIRGVHLAEHSLQVAHEEIGNILAFL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SEC22C Blocking Peptide, catalog no. 33R-3053, is also available for use as a blocking control in assays to test for specificity of this SEC22C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEC20 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SEC22C

Target: SEC22C (SEC22 Vesicle Trafficking Protein Homolog C (SEC22C))

Andere Bezeichnung: SEC22C (SEC22C Produkte)

Hintergrund: The protein encoded by this gene is a member of the SEC22 family of vesicle trafficking proteins. It is localized at the endoplasmic reticulum and it is thought to play a role in the early stages of the ER-Golgi protein trafficking.

Molekulargewicht: 34 kDa (MW of target protein)