ENTPD7 Antikörper (Ectonucleoside Triphosphate diphosphohydrolase 7) (C-Term)

Details for Product anti-ENTPD7 Antibody No. ABIN634874
Antigen
Epitop
C-Term
4
2
1
1
Reaktivität
Human
23
9
6
4
4
3
3
2
2
1
1
Wirt
Kaninchen
23
Klonalität
Polyklonal
Konjugat
Dieser ENTPD7 Antikörper ist unkonjugiert
2
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
12
10
6
1
1
1
1
Optionen
Immunogen ENTPD7 antibody was raised using the C terminal of ENTPD7 corresponding to a region with amino acids EHRLKYQCFKSAWMYQVLHEGFHFPYDYPNLRTAQLVYDREVQWTLGAIL
Spezifität ENTPD7 antibody was raised against the C terminal of ENTPD7
Reinigung Affinity purified
Antigen
Andere Bezeichnung ENTPD7 (ENTPD7 Antibody Abstract)
Hintergrund ENTPD7 is a multi-pass membrane protein.It belongs to the GDA1/CD39 NTPase family. It preferentially hydrolyzes nucleoside 5'-triphosphates. The order of activity with respect to possible substrates is UTP > GTP > CTP.
Molekulargewicht 69 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

ENTPD7 Blocking Peptide, catalog no. 33R-2459, is also available for use as a blocking control in assays to test for specificity of this ENTPD7 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENTPD7 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Ectonucleoside Triphosphate diphosphohydrolase 7 (ENTPD7) (C-Term) antibody (ABIN634874) ENTPD7 antibody used at 1 ug/ml to detect target protein.