Thymopoietin Antikörper (N-Term)

Produktnummer ABIN634870

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Thymopoietin in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für Thymopoietin Antikörper (N-Term) (ABIN634870)

Target: Thymopoietin (TMPO)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Thymopoietin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Thymopoietin Antikörper

Bindungsspezifität: N-Term

Spezifität: Thymopoietin antibody was raised against the N terminal of TMPO

Aufreinigung: Affinity purified

Immunogen: Thymopoietin antibody was raised using the N terminal of TMPO corresponding to a region with amino acids MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Thymopoietin Blocking Peptide, (ABIN5616594), is also available for use as a blocking control in assays to test for specificity of this Thymopoietin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMPO antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Thymopoietin

Target: Thymopoietin (TMPO)

Andere Bezeichnung: Thymopoietin

Hintergrund: TMPO may be involved in the structural organization of the nucleus and in the post-mitotic nuclear assembly. It plays an important role, together with LMNA, in the nuclear anchorage of RB1.

Molekulargewicht: 39 kDa (MW of target protein)