KLHL31 Antikörper
-
- Target Alle KLHL31 Antikörper anzeigen
- KLHL31 (Kelch-Like 31 (KLHL31))
-
Reaktivität
- Maus, Human, Hund, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KLHL31 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Affinity purified
- Immunogen
- KLHL31 antibody was raised using a synthetic peptide corresponding to a region with amino acids TPRGWHCAVTLSDRVYVMGGSQLGPRGERVDVLTVECYSPATGQWSYAAP
- Top Product
- Discover our top product KLHL31 Primärantikörper
-
anti-Kelch-Like 31 (KLHL31) (AA 501-550) antibody
KLHL31 Reaktivität: Maus, Human, Hund, Ratte, Pferd WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Kelch-Like 31 (KLHL31) (C-Term) antibodyKLHL31 Reaktivität: Maus, Human, Hund, Ratte, Pferd, Rind (Kuh), Schwein, Kaninchen, Zebrafisch (Danio rerio) WB, IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KLHL31 Blocking Peptide, catalog no. 33R-9231, is also available for use as a blocking control in assays to test for specificity of this KLHL31 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHL31 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KLHL31 (Kelch-Like 31 (KLHL31))
- Andere Bezeichnung
- KLHL31 (KLHL31 Produkte)
- Synonyme
- 9830147P19Rik antikoerper, D930047P17Rik antikoerper, Kbtbd1 antikoerper, fb95e08 antikoerper, kbtbd1 antikoerper, klhl antikoerper, wu:fa31h10 antikoerper, wu:fb95e08 antikoerper, BKLHD6 antikoerper, KBTBD1 antikoerper, KLHL antikoerper, bA345L23.2 antikoerper, RGD1560540 antikoerper, kelch-like 31 antikoerper, kelch-like family member 31 antikoerper, kelch like family member 31 antikoerper, Klhl31 antikoerper, klhl31 antikoerper, KLHL31 antikoerper
- Hintergrund
- KLHL31 is a transcriptional repressor in MAPK/JNK signaling pathway to regulate cellular functions. Overexpression inhibits the transcriptional activities of both the TPA-response element (TRE) and serum response element (SRE)
- Molekulargewicht
- 70 kDa (MW of target protein)
-
