KLHL31 Antikörper

Produktnummer ABIN634869

Dieser Anti-KLHL31 Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von KLHL31 in WB und IHC. Geeignet für Maus, Human, Hund und Ratte.

Kurzübersicht für KLHL31 Antikörper (ABIN634869)

Target: KLHL31 (Kelch-Like 31 (KLHL31))

Reaktivität: Maus, Human, Hund, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KLHL31 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-KLHL31 Antikörper

Aufreinigung: Affinity purified

Immunogen: KLHL31 antibody was raised using a synthetic peptide corresponding to a region with amino acids TPRGWHCAVTLSDRVYVMGGSQLGPRGERVDVLTVECYSPATGQWSYAAP

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KLHL31 Blocking Peptide, (ABIN5614381), is also available for use as a blocking control in assays to test for specificity of this KLHL31 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHL31 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KLHL31

Target: KLHL31 (Kelch-Like 31 (KLHL31))

Andere Bezeichnung: KLHL31

Hintergrund: KLHL31 is a transcriptional repressor in MAPK/JNK signaling pathway to regulate cellular functions. Overexpression inhibits the transcriptional activities of both the TPA-response element (TRE) and serum response element (SRE)

Molekulargewicht: 70 kDa (MW of target protein)