SLC37A4 Antikörper

Produktnummer ABIN634867

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch SLC37A4 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für SLC37A4 Antikörper (ABIN634867)

Target: SLC37A4 (Solute Carrier Family 37 (Glucose-6-Phosphate Transporter), Member 4 (SLC37A4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC37A4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC37A4 Antikörper

Aufreinigung: Affinity purified

Immunogen: SLC37 A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSFLCLLLIHNEPADVGLRNLDPMPSEGKKGSLKEESTLQELLLSPYLWV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC37A4 Blocking Peptide, (ABIN5616245), is also available for use as a blocking control in assays to test for specificity of this SLC37A4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC37A4

Target: SLC37A4 (Solute Carrier Family 37 (Glucose-6-Phosphate Transporter), Member 4 (SLC37A4))

Andere Bezeichnung: SLC37A4

Hintergrund: SLC37A4 transports glucose-6-phosphate from the cytoplasm to the lumen of the endoplasmic reticulum. It forms with glucose-6-phosphatase the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it plays a central role in homeostatic regulation of blood glucose levels.

Molekulargewicht: 46 kDa (MW of target protein)

Pathways: Carbohydrate Homeostasis, Cellular Glucan Metabolic Process