KCC2 Antikörper

Produktnummer ABIN634866

Produktdetails anti-KCC2 Antikörper

Target: KCC2 (SLC12A5) (Solute Carrier Family 12 (Potassium-Chloride Transporter) Member 5 (SLC12A5))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SLC12 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids VQLIHDQSAPSCPSSSPSPGEEPEGEGETDPEKVHLTWTKDKSVAEKNKG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC12A5 Blocking Peptide, catalog no. 33R-9750, is also available for use as a blocking control in assays to test for specificity of this SLC12A5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCC2

Target: KCC2 (SLC12A5) (Solute Carrier Family 12 (Potassium-Chloride Transporter) Member 5 (SLC12A5))

Andere Bezeichnung: SLC12A5 (SLC12A5 Produkte)

Synonyme: Kcc2 antikoerper, KCC2 antikoerper, mKIAA1176 antikoerper, solute carrier family 12 member 5 antikoerper, solute carrier family 12, member 5 antikoerper, SLC12A5 antikoerper, Slc12a5 antikoerper

Hintergrund: K-Cl cotransporters are proteins that lower intracellular chloride concentrations below the electrochemical equilibrium potential.

Molekulargewicht: 123 kDa (MW of target protein)