Myoferlin (MYOF) Antikörper

Details zu Produkt Nr. ABIN634863
Antigen
Reaktivität
Human
16
8
2
1
1
1
1
1
1
Wirt
Kaninchen
11
5
Klonalität
Polyklonal
Applikation
Western Blotting (WB)
16
9
7
4
1
1
1
1
1
1
Optionen
Immunogen FER1 L3 antibody was raised using a synthetic peptide corresponding to a region with amino acids QTEFRIPPRLIIQIWDNDKFSLDDYLGFLELDLRHTIIPAKSPEKCRLDM
Reinigung Affinity purified
Antigen
Andere Bezeichnung FER1L3 (MYOF Antibody Abstract)
Hintergrund Mutations in dysferlin, a protein associated with the plasma membrane, can cause muscle weakness that affects both proximal and distal muscles. FER1L3 is a type II membrane protein that is structurally similar to dysferlin. It is a member of the ferlin family and associates with both plasma and nuclear membranes. The protein contains C2 domains that play a role in calcium-mediated membrane fusion events, suggesting that it may be involved in membrane regeneration and repair.
Molekulargewicht 235 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

FER1L3 Blocking Peptide, catalog no. 33R-7747, is also available for use as a blocking control in assays to test for specificity of this FER1L3 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FER0 3 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Myoferlin (MYOF) antibody (ABIN634863) FER1L3 antibody used at 1 ug/ml to detect target protein.