AREL1 Antikörper (Middle Region)

Produktnummer ABIN634861

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch AREL1 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für AREL1 Antikörper (Middle Region) (ABIN634861)

Target: AREL1 (Apoptosis Resistant E3 Ubiquitin Protein Ligase 1 (AREL1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AREL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-AREL1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: KIAA0317 antibody was raised against the middle region of KIAA0317

Aufreinigung: Affinity purified

Immunogen: KIAA0317 antibody was raised using the middle region of KIAA0317 corresponding to a region with amino acids VRARFTRSFLAQIIGLRMHYKYFETDDPEFYKSKVCFILNNDMSEMELVF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIAA0317 Blocking Peptide, (ABIN5614325), is also available for use as a blocking control in assays to test for specificity of this KIAA0317 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0317 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AREL1

Target: AREL1 (Apoptosis Resistant E3 Ubiquitin Protein Ligase 1 (AREL1))

Andere Bezeichnung: KIAA0317

Hintergrund: KIAA0317 contains 1 filamin repeat and 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain. The exact function of KIAA0317 remains unknown.

Molekulargewicht: 94 kDa (MW of target protein)