AREL1 Antikörper (Middle Region)

Produktnummer ABIN634861

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch AREL1 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für AREL1 Antikörper (Middle Region) (ABIN634861)

Target: AREL1 (Apoptosis Resistant E3 Ubiquitin Protein Ligase 1 (AREL1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AREL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-AREL1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: KIAA0317 antibody was raised against the middle region of KIAA0317

Aufreinigung: Affinity purified

Immunogen: KIAA0317 antibody was raised using the middle region of KIAA0317 corresponding to a region with amino acids VRARFTRSFLAQIIGLRMHYKYFETDDPEFYKSKVCFILNNDMSEMELVF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIAA0317 Blocking Peptide, catalog no. 33R-9768, is also available for use as a blocking control in assays to test for specificity of this KIAA0317 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0317 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AREL1

Target: AREL1 (Apoptosis Resistant E3 Ubiquitin Protein Ligase 1 (AREL1))

Andere Bezeichnung: KIAA0317

Hintergrund: KIAA0317 contains 1 filamin repeat and 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain. The exact function of KIAA0317 remains unknown.

Molekulargewicht: 94 kDa (MW of target protein)