PDE3B Antikörper (phosphodiesterase 3B, CGMP-Inhibited) (Middle Region)

Details for Product anti-PDE3B Antibody No. ABIN634856
Antigen
Epitop
Middle Region
8
8
7
7
6
5
5
4
3
2
2
1
1
Reaktivität
Human
56
24
19
12
12
2
2
1
1
1
1
1
Wirt
Kaninchen
52
4
4
1
Klonalität
Polyklonal
Konjugat
Dieser PDE3B Antikörper ist unkonjugiert
7
6
2
2
2
2
1
1
1
1
1
1
Applikation
Western Blotting (WB)
55
33
18
17
17
11
7
5
1
1
Optionen
Immunogen PDE3 B antibody was raised using the middle region of PDE3 corresponding to a region with amino acids SRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKANDVN
Spezifität PDE3 B antibody was raised against the middle region of PDE3
Reinigung Affinity purified
Antigen
Andere Bezeichnung PDE3B
Hintergrund PDE3B belongs to the cyclic nucleotide phosphodiesterase family. It may play a role in fat metabolism.
Molekulargewicht 124 kDa (MW of target protein)
Pathways Negative Regulation of Hormone Secretion, Carbohydrate Homeostasis, cAMP Metabolic Process
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

PDE3B Blocking Peptide, catalog no. 33R-8765, is also available for use as a blocking control in assays to test for specificity of this PDE3B antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDE0 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-phosphodiesterase 3B, CGMP-Inhibited (PDE3B) (Middle Region) antibody (ABIN634856) PDE3B antibody used at 1 ug/ml to detect target protein.