PDE3B Antikörper (Middle Region)
-
- Target Alle PDE3B Antikörper anzeigen
- PDE3B (phosphodiesterase 3B, CGMP-Inhibited (PDE3B))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PDE3B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PDE3 B antibody was raised against the middle region of PDE3
- Aufreinigung
- Affinity purified
- Immunogen
- PDE3 B antibody was raised using the middle region of PDE3 corresponding to a region with amino acids SRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKANDVN
- Top Product
- Discover our top product PDE3B Primärantikörper
-
anti-phosphodiesterase 3B, CGMP-Inhibited (PDE3B) (AA 400-427) antibody
PDE3B Reaktivität: Human WB, IF, FACS Wirt: Kaninchen Polyclonal RB31670 unconjugated
anti-phosphodiesterase 3B, CGMP-Inhibited (PDE3B) (AA 401-500) antibodyPDE3B Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-phosphodiesterase 3B, CGMP-Inhibited (PDE3B) (AA 401-500) antibodyPDE3B Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 4A4 unconjugated
anti-phosphodiesterase 3B, CGMP-Inhibited (PDE3B) (AA 407-435), (Middle Region) antibodyPDE3B Reaktivität: Human WB, IF, FACS, EIA Wirt: Kaninchen Polyclonal unconjugated
anti-phosphodiesterase 3B, CGMP-Inhibited (PDE3B) (AA 400-660) antibodyPDE3B Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-phosphodiesterase 3B, CGMP-Inhibited (PDE3B) (AA 864-913) antibodyPDE3B Reaktivität: Human, Maus, Ratte, Rind (Kuh), Meerschweinchen WB Wirt: Kaninchen Polyclonal unconjugated
anti-phosphodiesterase 3B, CGMP-Inhibited (PDE3B) antibodyPDE3B Reaktivität: Ratte WB, IP Wirt: Ziege Polyclonal unconjugated
anti-phosphodiesterase 3B, CGMP-Inhibited (PDE3B) antibodyPDE3B Reaktivität: Ratte WB, IP Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PDE3B Blocking Peptide, catalog no. 33R-8765, is also available for use as a blocking control in assays to test for specificity of this PDE3B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDE0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PDE3B (phosphodiesterase 3B, CGMP-Inhibited (PDE3B))
- Andere Bezeichnung
- PDE3B (PDE3B Produkte)
- Synonyme
- PDE3B antikoerper, HcGIP1 antikoerper, cGIPDE1 antikoerper, 9830102A01Rik antikoerper, AI847709 antikoerper, phosphodiesterase 3B antikoerper, phosphodiesterase 3B, cGMP-inhibited antikoerper, si:ch211-79e4.4 antikoerper, phosphodiesterase 3B L homeolog antikoerper, PDE3B antikoerper, pde3b antikoerper, Pde3b antikoerper, si:ch211-79e4.4 antikoerper, pde3b.L antikoerper
- Hintergrund
- PDE3B belongs to the cyclic nucleotide phosphodiesterase family. It may play a role in fat metabolism.
- Molekulargewicht
- 124 kDa (MW of target protein)
- Pathways
- Negative Regulation of Hormone Secretion, Carbohydrate Homeostasis, cAMP Metabolic Process
-
