PDE3B Antikörper (Middle Region)

Produktnummer ABIN634856

Der Kaninchen Polyklonal Anti-PDE3B-Antikörper wurde für WB validiert. Er ist geeignet, PDE3B in Proben von Human zu detektieren.

Kurzübersicht für PDE3B Antikörper (Middle Region) (ABIN634856)

Target: PDE3B (phosphodiesterase 3B, CGMP-Inhibited (PDE3B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PDE3B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PDE3B Antikörper

Bindungsspezifität: Middle Region

Spezifität: PDE3 B antibody was raised against the middle region of PDE3

Aufreinigung: Affinity purified

Immunogen: PDE3 B antibody was raised using the middle region of PDE3 corresponding to a region with amino acids SRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKANDVN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PDE3B Blocking Peptide, (ABIN5615273), is also available for use as a blocking control in assays to test for specificity of this PDE3B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDE0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PDE3B

Target: PDE3B (phosphodiesterase 3B, CGMP-Inhibited (PDE3B))

Andere Bezeichnung: PDE3B

Hintergrund: PDE3B belongs to the cyclic nucleotide phosphodiesterase family. It may play a role in fat metabolism.

Molekulargewicht: 124 kDa (MW of target protein)

Pathways: Negative Regulation of Hormone Secretion, Carbohydrate Homeostasis, cAMP Metabolic Process