SLC23A2 Antikörper (Solute Carrier Family 23 (Nucleobase Transporters), Member 2)

Details for Product anti-SLC23A2 Antibody No. ABIN634854
Antigen
Reaktivität
Human, Maus, Ratte (Rattus)
27
14
13
2
2
2
2
2
1
1
1
1
1
Wirt
Kaninchen
28
Klonalität
Polyklonal
Konjugat
Dieser SLC23A2 Antikörper ist unkonjugiert
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
23
12
6
2
1
1
1
Optionen
Immunogen SLC23 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VALIGLSGFQAAGERAGKHWGIAMLTIFLVLLFSQYARNVKFPLPIYKSK
Reinigung Affinity purified
Antigen
Andere Bezeichnung SLC23A2 (SLC23A2 Antibody Abstract)
Hintergrund The absorption of vitamin C into the body and its distribution to organs requires two sodium-dependent vitamin C transporters. This gene encodes one of the two required transporters and the encoded protein accounts for tissue-specific uptake of vitamin C. Previously, this gene had an official symbol of SLC23A1.
Molekulargewicht 70 kDa (MW of target protein)
Pathways Skeletal Muscle Fiber Development
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

SLC23A2 Blocking Peptide, catalog no. 33R-9424, is also available for use as a blocking control in assays to test for specificity of this SLC23A2 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 2 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Solute Carrier Family 23 (Nucleobase Transporters), Member 2 (SLC23A2) antibody (ABIN634854) SLC23A2 antibody used at 1 ug/ml to detect target protein.