STEAP Family Member 3, Metalloreductase (STEAP3) (C-Term) Antikörper

Details zu Produkt Nr. ABIN634853
Antigen
Epitop
C-Term
13
11
8
8
4
1
1
1
1
Reaktivität
Human
65
33
32
4
3
3
3
2
2
1
1
Wirt
Kaninchen
65
Klonalität
Polyklonal
Konjugat
Unkonjugiert
4
3
3
2
2
2
1
1
1
1
1
1
Applikation
Western Blotting (WB)
57
32
21
9
8
4
3
2
1
1
1
1
Optionen
Immunogen STEAP3 antibody was raised using the C terminal of STEAP3 corresponding to a region with amino acids VALVLSTLHTLTYGWTRAFEESRYKFYLPPTFTLTLLVPCVVILAKALFL
Spezifität STEAP3 antibody was raised against the C terminal of STEAP3
Reinigung Affinity purified
Antigen
Andere Bezeichnung STEAP3 (STEAP3 Antibody Abstract)
Hintergrund AS an endosomal ferrireductase, STEAP3 is required for efficient transferrin-dependent iron uptake in erythroid cells. It participates in erythroid iron homeostasis by reducing Fe(3+) to Fe(2+) and can also reduce of Cu(2+) to Cu(1+), suggesting that it participates in copper homeostasis. STEAP3 uses NAD(+) as acceptor (By similarity). It may play a role downstream of p53/TP53 to interface apoptosis and cell cycle progression. STEAP3 is indirectly involved in exosome secretion by facilitating the secretion of proteins such as TCT.
Molekulargewicht 56 kDa (MW of target protein)
Pathways Transition Metal Ion Homeostasis
Applikations-hinweise WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

STEAP3 Blocking Peptide, catalog no. 33R-9427, is also available for use as a blocking control in assays to test for specificity of this STEAP3 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STEAP3 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-STEAP Family Member 3, Metalloreductase (STEAP3) (C-Term) antibody (ABIN634853) STEAP3 antibody used at 0.25 ug/ml to detect target protein.