STEAP3 Antikörper (C-Term)
-
- Target Alle STEAP3 Antikörper anzeigen
- STEAP3 (STEAP Family Member 3, Metalloreductase (STEAP3))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser STEAP3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- STEAP3 antibody was raised against the C terminal of STEAP3
- Aufreinigung
- Affinity purified
- Immunogen
- STEAP3 antibody was raised using the C terminal of STEAP3 corresponding to a region with amino acids VALVLSTLHTLTYGWTRAFEESRYKFYLPPTFTLTLLVPCVVILAKALFL
- Top Product
- Discover our top product STEAP3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
STEAP3 Blocking Peptide, catalog no. 33R-9427, is also available for use as a blocking control in assays to test for specificity of this STEAP3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STEAP3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- STEAP3 (STEAP Family Member 3, Metalloreductase (STEAP3))
- Andere Bezeichnung
- STEAP3 (STEAP3 Produkte)
- Hintergrund
- AS an endosomal ferrireductase, STEAP3 is required for efficient transferrin-dependent iron uptake in erythroid cells. It participates in erythroid iron homeostasis by reducing Fe(3+) to Fe(2+) and can also reduce of Cu(2+) to Cu(1+), suggesting that it participates in copper homeostasis. STEAP3 uses NAD(+) as acceptor (By similarity). It may play a role downstream of p53/TP53 to interface apoptosis and cell cycle progression. STEAP3 is indirectly involved in exosome secretion by facilitating the secretion of proteins such as TCT.
- Molekulargewicht
- 56 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-