STEAP3 Antikörper (C-Term)

Produktnummer ABIN634853

Der Kaninchen Polyklonal Anti-STEAP3-Antikörper wurde für WB validiert. Er ist geeignet, STEAP3 in Proben von Human zu detektieren.

Kurzübersicht für STEAP3 Antikörper (C-Term) (ABIN634853)

Target: STEAP3 (STEAP Family Member 3, Metalloreductase (STEAP3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser STEAP3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-STEAP3 Antikörper

Bindungsspezifität: C-Term

Spezifität: STEAP3 antibody was raised against the C terminal of STEAP3

Aufreinigung: Affinity purified

Immunogen: STEAP3 antibody was raised using the C terminal of STEAP3 corresponding to a region with amino acids VALVLSTLHTLTYGWTRAFEESRYKFYLPPTFTLTLLVPCVVILAKALFL

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

STEAP3 Blocking Peptide, (ABIN5616436), is also available for use as a blocking control in assays to test for specificity of this STEAP3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STEAP3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu STEAP3

Target: STEAP3 (STEAP Family Member 3, Metalloreductase (STEAP3))

Andere Bezeichnung: STEAP3

Hintergrund: AS an endosomal ferrireductase, STEAP3 is required for efficient transferrin-dependent iron uptake in erythroid cells. It participates in erythroid iron homeostasis by reducing Fe(3+) to Fe(2+) and can also reduce of Cu(2+) to Cu(1+), suggesting that it participates in copper homeostasis. STEAP3 uses NAD(+) as acceptor (By similarity). It may play a role downstream of p53/TP53 to interface apoptosis and cell cycle progression. STEAP3 is indirectly involved in exosome secretion by facilitating the secretion of proteins such as TCT.

Molekulargewicht: 56 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis