ABCF3 Antikörper

Produktnummer ABIN634851

Produktdetails anti-ABCF3 Antikörper

Target: ABCF3 (ATP-Binding Cassette, Sub-Family F (GCN20), Member 3 (ABCF3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ABCF3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ABCF3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDLVEAVGELLQEVSGDSKDDAGIRAVCQRMYNTLRLAEPQSQGNSQVLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ABCF3 Blocking Peptide, catalog no. 33R-1883, is also available for use as a blocking control in assays to test for specificity of this ABCF3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCF3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ABCF3

Target: ABCF3 (ATP-Binding Cassette, Sub-Family F (GCN20), Member 3 (ABCF3))

Andere Bezeichnung: ABCF3 (ABCF3 Produkte)

Synonyme: ABCF3 antikoerper, DKFZp459M1517 antikoerper, EST201864 antikoerper, AI326318 antikoerper, AU016058 antikoerper, BB119416 antikoerper, ATP binding cassette subfamily F member 3 antikoerper, ATP-binding cassette sub-family F member 3 antikoerper, ATP-binding cassette, sub-family F (GCN20), member 3 antikoerper, ABCF3 antikoerper, CpipJ_CPIJ014150 antikoerper, PTRG_01254 antikoerper, PTRG_00878 antikoerper, VDBG_00967 antikoerper, MGYG_07201 antikoerper, Abcf3 antikoerper

Hintergrund: ABCF3 belongs to the ABC transporter family, EF3 subfamily. It contains 2 ABC transporter domains. The exact function of ABCF3 remains unknown.

Molekulargewicht: 78 kDa (MW of target protein)