ABCF3 Antikörper
-
- Target Alle ABCF3 Produkte
- ABCF3 (ATP-Binding Cassette, Sub-Family F (GCN20), Member 3 (ABCF3))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ABCF3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ABCF3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDLVEAVGELLQEVSGDSKDDAGIRAVCQRMYNTLRLAEPQSQGNSQVLL
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ABCF3 Blocking Peptide, catalog no. 33R-1883, is also available for use as a blocking control in assays to test for specificity of this ABCF3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCF3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ABCF3 (ATP-Binding Cassette, Sub-Family F (GCN20), Member 3 (ABCF3))
- Andere Bezeichnung
- ABCF3 (ABCF3 Produkte)
- Hintergrund
- ABCF3 belongs to the ABC transporter family, EF3 subfamily. It contains 2 ABC transporter domains. The exact function of ABCF3 remains unknown.
- Molekulargewicht
- 78 kDa (MW of target protein)
-