TMEM135 Antikörper (N-Term)

Produktnummer ABIN634847

Der Kaninchen Polyklonal Anti-TMEM135-Antikörper wurde für WB validiert. Er ist geeignet, TMEM135 in Proben von Human zu detektieren.

Kurzübersicht für TMEM135 Antikörper (N-Term) (ABIN634847)

Target: TMEM135 (Transmembrane Protein 135 (TMEM135))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM135 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TMEM135 Antikörper

Bindungsspezifität: N-Term

Spezifität: TMEM135 antibody was raised against the N terminal of TMEM135

Aufreinigung: Affinity purified

Immunogen: TMEM135 antibody was raised using the N terminal of TMEM135 corresponding to a region with amino acids SLKIYAPLYLIAAILRKRKLDYYLHKLLPEILQSASFLTANGALYMAFFC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM135 Blocking Peptide, (ABIN5616662), is also available for use as a blocking control in assays to test for specificity of this TMEM135 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM135 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM135

Target: TMEM135 (Transmembrane Protein 135 (TMEM135))

Andere Bezeichnung: TMEM135

Hintergrund: TMEM135 protein is part of a conserved genetic network involved in fat storage and longevity regulation.

Molekulargewicht: 52 kDa (MW of target protein)