MDM1 Antikörper (N-Term)

Produktnummer ABIN634846

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch MDM1 in WB. Er zeigt eine Reaktivität gegenüber Human und Maus.

Kurzübersicht für MDM1 Antikörper (N-Term) (ABIN634846)

Target: MDM1 (Mdm1 Nuclear Protein (MDM1))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MDM1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MDM1 Antikörper

Bindungsspezifität: N-Term

Spezifität: MDM1 antibody was raised against the N terminal of MDM1

Aufreinigung: Affinity purified

Immunogen: MDM1 antibody was raised using the N terminal of MDM1 corresponding to a region with amino acids GLRSDQLGITKEPSFISKRRVPYHDPQISKSLEWNGAISESNVVASPEPE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MDM1 Blocking Peptide, (ABIN938806), is also available for use as a blocking control in assays to test for specificity of this MDM1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MDM1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MDM1

Target: MDM1 (Mdm1 Nuclear Protein (MDM1))

Andere Bezeichnung: MDM1

Hintergrund: MDM1 is a nuclear protein similar to the mouse double minute 1 protein. The mouse gene is located in double minute (DM) chromatin particles and is amplified in the mouse transformed 3T3 cell line, and the protein is able to bind to p53.

Molekulargewicht: 25 kDa (MW of target protein)