SLC43A2 Antikörper (N-Term)

Produktnummer ABIN634843

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch SLC43A2 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für SLC43A2 Antikörper (N-Term) (ABIN634843)

Target: SLC43A2 (Solute Carrier Family 43, Member 2 (SLC43A2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC43A2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC43A2 Antikörper

Bindungsspezifität: N-Term

Spezifität: SLC43 A2 antibody was raised against the N terminal of SLC43 2

Aufreinigung: Affinity purified

Immunogen: SLC43 A2 antibody was raised using the N terminal of SLC43 2 corresponding to a region with amino acids TEPENVTNGTVGGTAEPGHEEVSWMNGWLSCQAQDEMLNLAFTVGSFLLS

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC43A2 Blocking Peptide, (ABIN5616255), is also available for use as a blocking control in assays to test for specificity of this SLC43A2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC43A2

Target: SLC43A2 (Solute Carrier Family 43, Member 2 (SLC43A2))

Andere Bezeichnung: SLC43A2

Hintergrund: SLC43A2 is a Sodium-, chloride, pH-independent high affinity transport of large neutral amino acids.

Molekulargewicht: 53 kDa (MW of target protein)