ABCE1 Antikörper (ATP-Binding Cassette, Sub-Family E (OABP), Member 1)

Details for Product anti-ABCE1 Antibody No. ABIN634841
Antigen
Reaktivität
Human, Maus, Ratte (Rattus)
74
36
25
3
3
2
2
2
2
1
1
1
1
1
Wirt
Kaninchen
60
15
Klonalität
Polyklonal
Konjugat
Dieser ABCE1 Antikörper ist unkonjugiert
5
5
4
4
4
4
2
2
2
2
2
2
1
1
1
1
1
Applikation
Western Blotting (WB)
51
43
13
8
3
2
2
1
1
Optionen
Immunogen ABCE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD
Reinigung Affinity purified
Antigen
Andere Bezeichnung ABCE1 (ABCE1 Antibody Abstract)
Hintergrund ABCE1 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the OABP subfamily. Alternatively referred to as the RNase L inhibitor, this protein functions to block the activity of ribonuclease L. Activation of ribonuclease L leads to inhibition of protein synthesis in the 2-5A/RNase L system, the central pathway for viral interferon action.
Molekulargewicht 67 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

ABCE1 Blocking Peptide, catalog no. 33R-4770, is also available for use as a blocking control in assays to test for specificity of this ABCE1 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCE1 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-ATP-Binding Cassette, Sub-Family E (OABP), Member 1 (ABCE1) antibody (ABIN634841) ABCE1 antibody used at 1 ug/ml to detect target protein.