ABCE1 Antikörper
-
- Target Alle ABCE1 Antikörper anzeigen
- ABCE1 (ATP-Binding Cassette, Sub-Family E (OABP), Member 1 (ABCE1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ABCE1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ABCE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD
- Top Product
- Discover our top product ABCE1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ABCE1 Blocking Peptide, catalog no. 33R-4770, is also available for use as a blocking control in assays to test for specificity of this ABCE1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCE1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ABCE1 (ATP-Binding Cassette, Sub-Family E (OABP), Member 1 (ABCE1))
- Andere Bezeichnung
- ABCE1 (ABCE1 Produkte)
- Synonyme
- ABCE1 antikoerper, DDBDRAFT_0188931 antikoerper, DDBDRAFT_0191227 antikoerper, DDB_0188931 antikoerper, DDB_0191227 antikoerper, abce1 antikoerper, MGC69546 antikoerper, DKFZp469K1416 antikoerper, ABC38 antikoerper, OABP antikoerper, RLI antikoerper, RNASEL1 antikoerper, RNASELI antikoerper, RNS4I antikoerper, C79080 antikoerper, Oabp antikoerper, RNS41 antikoerper, Rnaseli antikoerper, wu:fb34c09 antikoerper, wu:fe47b01 antikoerper, wu:fi09g07 antikoerper, zgc:111906 antikoerper, zgc:56045 antikoerper, Rns4i antikoerper, ATP binding cassette subfamily E member 1 antikoerper, 4Fe-4S ferredoxin, iron-sulfur binding domain-containing protein antikoerper, ATP-binding cassette sub-family E member 1 antikoerper, RNAse L inhibitor antikoerper, RNase L inhibitor antikoerper, ribosome biogenesis/translation initiation ATPase RLI antikoerper, ATP-binding cassette, sub-family E (OABP), member 1 antikoerper, ATP binding cassette subfamily E member 1 S homeolog antikoerper, ABCE1 antikoerper, abcE1 antikoerper, LOC100184673 antikoerper, LOC100213121 antikoerper, abce1 antikoerper, TP04_0855 antikoerper, PVX_115370 antikoerper, TERMP_RS03360 antikoerper, Abce1 antikoerper, abce1.S antikoerper
- Hintergrund
- ABCE1 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the OABP subfamily. Alternatively referred to as the RNase L inhibitor, this protein functions to block the activity of ribonuclease L. Activation of ribonuclease L leads to inhibition of protein synthesis in the 2-5A/RNase L system, the central pathway for viral interferon action.
- Molekulargewicht
- 67 kDa (MW of target protein)
-