ABCE1 Antikörper

Produktnummer ABIN634841

Der Kaninchen Polyklonal anti-ABCE1 Antikörper wird verwendet zum Nachweis von ABCE1 in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für ABCE1 Antikörper (ABIN634841)

Target: ABCE1 (ATP-Binding Cassette, Sub-Family E (OABP), Member 1 (ABCE1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ABCE1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ABCE1 Antikörper

Aufreinigung: Affinity purified

Immunogen: ABCE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ABCE1 Blocking Peptide, (ABIN940156), is also available for use as a blocking control in assays to test for specificity of this ABCE1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCE1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ABCE1

Target: ABCE1 (ATP-Binding Cassette, Sub-Family E (OABP), Member 1 (ABCE1))

Andere Bezeichnung: ABCE1

Hintergrund: ABCE1 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the OABP subfamily. Alternatively referred to as the RNase L inhibitor, this protein functions to block the activity of ribonuclease L. Activation of ribonuclease L leads to inhibition of protein synthesis in the 2-5A/RNase L system, the central pathway for viral interferon action.

Molekulargewicht: 67 kDa (MW of target protein)