Arylsulfatase H Antikörper (ARSH) (Middle Region)

Details for Product anti-ARSH Antibody No. ABIN634839
Antigen
Epitop
Middle Region
7
4
4
1
1
1
Reaktivität
Human
46
3
2
2
2
2
1
1
Wirt
Kaninchen
36
7
4
Klonalität
Polyklonal
Konjugat
Dieser Arylsulfatase H Antikörper ist unkonjugiert
4
3
3
2
2
2
2
2
2
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
20
15
13
3
1
1
1
Optionen
Immunogen ARSH antibody was raised using the middle region of ARSH corresponding to a region with amino acids FIERYKREPFLLFFSFLHVHTPLISKKKFVGRSKYGRYGDNVEEMDWMVG
Spezifität ARSH antibody was raised against the middle region of ARSH
Reinigung Affinity purified
Antigen
Andere Bezeichnung ARSH (ARSH Antibody Abstract)
Hintergrund Sulfatases, such as ARSH, hydrolyze sulfate esters from sulfated steroids, carbohydrates, proteoglycans, and glycolipids. They are involved in hormone biosynthesis, modulation of cell signaling, and degradation of macromolecules.
Molekulargewicht 63 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

ARSH Blocking Peptide, catalog no. 33R-2924, is also available for use as a blocking control in assays to test for specificity of this ARSH antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARSH antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Arylsulfatase H (ARSH) (Middle Region) antibody (ABIN634839) ARSH antibody used at 1 ug/ml to detect target protein.