Arylsulfatase H Antikörper (Middle Region)

Produktnummer ABIN634839

Dieses Anti-Arylsulfatase H-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Arylsulfatase H in WB. Geeignet für Human.

Kurzübersicht für Arylsulfatase H Antikörper (Middle Region) (ABIN634839)

Target: Arylsulfatase H (ARSH)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Arylsulfatase H Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Arylsulfatase H Antikörper

Bindungsspezifität: Middle Region

Spezifität: ARSH antibody was raised against the middle region of ARSH

Aufreinigung: Affinity purified

Immunogen: ARSH antibody was raised using the middle region of ARSH corresponding to a region with amino acids FIERYKREPFLLFFSFLHVHTPLISKKKFVGRSKYGRYGDNVEEMDWMVG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ARSH Blocking Peptide, (ABIN938310), is also available for use as a blocking control in assays to test for specificity of this ARSH antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARSH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Arylsulfatase H

Target: Arylsulfatase H (ARSH)

Andere Bezeichnung: ARSH

Hintergrund: Sulfatases, such as ARSH, hydrolyze sulfate esters from sulfated steroids, carbohydrates, proteoglycans, and glycolipids. They are involved in hormone biosynthesis, modulation of cell signaling, and degradation of macromolecules.

Molekulargewicht: 63 kDa (MW of target protein)