RNF19A Antikörper (N-Term)

Produktnummer ABIN634836

Dieses Anti-RNF19A-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von RNF19A in WB. Geeignet für Human und Maus.

Kurzübersicht für RNF19A Antikörper (N-Term) (ABIN634836)

Target: RNF19A (Ring Finger Protein 19A (RNF19A))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RNF19A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RNF19A Antikörper

Bindungsspezifität: N-Term

Spezifität: RNF19 A antibody was raised against the N terminal of RNF19

Aufreinigung: Affinity purified

Immunogen: RNF19 A antibody was raised using the N terminal of RNF19 corresponding to a region with amino acids IFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RNF19A Blocking Peptide, (ABIN939348), is also available for use as a blocking control in assays to test for specificity of this RNF19A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RNF19A

Target: RNF19A (Ring Finger Protein 19A (RNF19A))

Andere Bezeichnung: RNF19A

Hintergrund: RNF19A contains two RING-finger motifs and an IBR (in between RING fingers) motif. This protein is an E3 ubiquintin ligase that is localized in Lewy bodies (LBs), a characteristic neuronal inclusion in Parkinson's disease (PD) brains. This protein interacts with UBE2L3/UBCH7 and UBE2E2/UBCH8, but not other ubiquitin-conjugating enzymes. This protein is found to bind and ubiquitylate synphilin 1 (SNCAIP), which is a interacting protein of alpha synuclein in neurons, and a major component of LB.

Molekulargewicht: 91 kDa (MW of target protein)