CTDNEP1A Antikörper (CTD Nuclear Envelope Phosphatase 1a)

Details for Product anti-CTDNEP1A Antibody No. ABIN634833
Antigen
Reaktivität
Human, Maus, Ratte (Rattus)
37
4
4
2
2
2
2
2
2
1
1
1
1
Wirt
Kaninchen
37
Klonalität
Polyklonal
Konjugat
Dieser CTDNEP1A Antikörper ist unkonjugiert
6
6
6
2
2
2
Applikation
Western Blotting (WB)
33
30
27
15
8
1
1
Optionen
Immunogen DULLARD antibody was raised using a synthetic peptide corresponding to a region with amino acids HPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW
Reinigung Affinity purified
Antigen
Andere Bezeichnung DULLARD (CTDNEP1A Antibody Abstract)
Hintergrund DULLARD is a serine/threonine phosphatase which may be required for proper nuclear membrane morphology. DULLARD was involved in LPIN1 dephosphorylation. It may antagonize BMP signaling.
Molekulargewicht 28 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

DULLARD Blocking Peptide, catalog no. 33R-3807, is also available for use as a blocking control in assays to test for specificity of this DULLARD antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DULLARD antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-CTD Nuclear Envelope Phosphatase 1a (CTDNEP1A) antibody (ABIN634833) DULLARD antibody used at 1 ug/ml to detect target protein.