CTDNEP1A Antikörper

Produktnummer ABIN634833

Dieses Anti-CTDNEP1A-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von CTDNEP1A in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für CTDNEP1A Antikörper (ABIN634833)

Target: CTDNEP1A (CTD Nuclear Envelope Phosphatase 1a (CTDNEP1A))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CTDNEP1A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CTDNEP1A Antikörper

Aufreinigung: Affinity purified

Immunogen: DULLARD antibody was raised using a synthetic peptide corresponding to a region with amino acids HPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DULLARD Blocking Peptide, (ABIN939193), is also available for use as a blocking control in assays to test for specificity of this DULLARD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DULLARD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CTDNEP1A

Target: CTDNEP1A (CTD Nuclear Envelope Phosphatase 1a (CTDNEP1A))

Andere Bezeichnung: DULLARD

Hintergrund: DULLARD is a serine/threonine phosphatase which may be required for proper nuclear membrane morphology. DULLARD was involved in LPIN1 dephosphorylation. It may antagonize BMP signaling.

Molekulargewicht: 28 kDa (MW of target protein)